Lineage for d5anva_ (5anv A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2211445Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2211446Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2211447Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2211448Protein 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 [103207] (1 species)
  7. 2211449Species Human (Homo sapiens) [TaxId:9606] [103208] (20 PDB entries)
  8. 2211452Domain d5anva_: 5anv A: [312510]
    automated match to d1irya_
    complexed with rgj

Details for d5anva_

PDB Entry: 5anv (more details), 1.16 Å

PDB Description: mth1 in complex with compound 15
PDB Compounds: (A:) 7,8-dihydro-8-oxoguanine triphosphatase

SCOPe Domain Sequences for d5anva_:

Sequence, based on SEQRES records: (download)

>d5anva_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]}
asrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesgltvd
alhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpddsy
wfplllqkkkfhgyfkfqgqdtildytlrevdtv

Sequence, based on observed residues (ATOM records): (download)

>d5anva_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]}
asrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesgltvd
alhkvgqivfefvgepelmdvhvfctsiqgtpvesdemrpcwfqldqipfkdmwpddsyw
fplllqkkkfhgyfkfqgqdtildytlrevdtv

SCOPe Domain Coordinates for d5anva_:

Click to download the PDB-style file with coordinates for d5anva_.
(The format of our PDB-style files is described here.)

Timeline for d5anva_: