![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
![]() | Family d.113.1.1: MutT-like [55812] (17 proteins) |
![]() | Protein 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 [103207] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [103208] (79 PDB entries) |
![]() | Domain d5anva_: 5anv A: [312510] automated match to d1irya_ complexed with rgj has additional insertions and/or extensions that are not grouped together |
PDB Entry: 5anv (more details), 1.16 Å
SCOPe Domain Sequences for d5anva_:
Sequence, based on SEQRES records: (download)
>d5anva_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} asrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesgltvd alhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpddsy wfplllqkkkfhgyfkfqgqdtildytlrevdtv
>d5anva_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} asrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesgltvd alhkvgqivfefvgepelmdvhvfctsiqgtpvesdemrpcwfqldqipfkdmwpddsyw fplllqkkkfhgyfkfqgqdtildytlrevdtv
Timeline for d5anva_: