| Class b: All beta proteins [48724] (177 folds) |
| Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
| Family b.33.1.0: automated matches [191455] (1 protein) not a true family |
| Protein automated matches [190701] (11 species) not a true protein |
| Species Burkholderia xenovorans [TaxId:266265] [226023] (9 PDB entries) |
| Domain d5aewe1: 5aew E:18-179 [312508] Other proteins in same PDB: d5aewa2, d5aewb_, d5aewc2, d5aewd_, d5aewe2, d5aewf_, d5aewg2, d5aewh_, d5aewi2, d5aewj_, d5aewk2, d5aewl_, d5aewm2, d5aewn_, d5aewo2, d5aewp_, d5aewq2, d5aewr_, d5aews2, d5aewt_, d5aewu2, d5aewv_, d5aeww2, d5aewx_ automated match to d2yfia1 complexed with bnl, fe2, fes |
PDB Entry: 5aew (more details), 1.88 Å
SCOPe Domain Sequences for d5aewe1:
Sequence, based on SEQRES records: (download)
>d5aewe1 b.33.1.0 (E:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvq
>d5aewe1 b.33.1.0 (E:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeaffdkaewgplqarvatykglvfanwdvq
Timeline for d5aewe1:
View in 3DDomains from other chains: (mouse over for more information) d5aewa1, d5aewa2, d5aewb_, d5aewc1, d5aewc2, d5aewd_, d5aewf_, d5aewg1, d5aewg2, d5aewh_, d5aewi1, d5aewi2, d5aewj_, d5aewk1, d5aewk2, d5aewl_, d5aewm1, d5aewm2, d5aewn_, d5aewo1, d5aewo2, d5aewp_, d5aewq1, d5aewq2, d5aewr_, d5aews1, d5aews2, d5aewt_, d5aewu1, d5aewu2, d5aewv_, d5aeww1, d5aeww2, d5aewx_ |