SCOPe 2.08: Domain d5aeww2: 5aew W:180-459

Lineage for d5aeww2 (5aew W:180-459)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (21 species)
   not a true protein

7. Species Burkholderia xenovorans [TaxId:266265] [226024] (9 PDB entries)

8. Domain d5aeww2: 5aew W:180-459 [312504]
   Other proteins in same PDB: d5aewa1, d5aewb_, d5aewc1, d5aewd_, d5aewe1, d5aewf_, d5aewg1, d5aewh_, d5aewi1, d5aewj_, d5aewk1, d5aewl_, d5aewm1, d5aewn_, d5aewo1, d5aewp_, d5aewq1, d5aewr_, d5aews1, d5aewt_, d5aewu1, d5aewv_, d5aeww1, d5aewx_
   automated match to d2xr8a2
   complexed with bnl, fe2, fes

Details for d5aeww2

PDB Entry: 5aew, 1.88 Å

PDB Description: crystal structure of ii9 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 in complex with biphenyl

PDB Compounds: (W:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d5aeww2:

Sequence; same for both SEQRES and ATOM records:

>d5aeww2 d.129.3.0 (W:180-459) automated matches {Burkholderia xenovorans [TaxId: 266265]}
apdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttth
lsgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywteg
paaelaeqrlghtgmpvrrmvgqhmtifptcsflpgintirtwhprgpneievwaftlvd
adapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsq
tghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp

Timeline for d5aeww2:

• d5aeww2 first appeared in SCOPe 2.06
  
• d5aeww2 appears in SCOPe 2.07