Class b: All beta proteins [48724] (177 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.0: automated matches [191455] (1 protein) not a true family |
Protein automated matches [190701] (11 species) not a true protein |
Species Burkholderia xenovorans [TaxId:266265] [226023] (9 PDB entries) |
Domain d5aeuc1: 5aeu C:18-179 [312493] Other proteins in same PDB: d5aeua2, d5aeub_, d5aeuc2, d5aeud_, d5aeue2, d5aeuf_, d5aeug2, d5aeuh_ automated match to d2yfia1 complexed with fe2, fes |
PDB Entry: 5aeu (more details), 2.49 Å
SCOPe Domain Sequences for d5aeuc1:
Sequence, based on SEQRES records: (download)
>d5aeuc1 b.33.1.0 (C:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]} nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp fekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvq
>d5aeuc1 b.33.1.0 (C:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]} nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp fekeaffdkaewgplqarvatykglvfanwdvq
Timeline for d5aeuc1: