SCOPe 2.08: Domain d4y9ub1: 4y9u B:63-235

Lineage for d4y9ub1 (4y9u B:63-235)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (31 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [255999] (16 PDB entries)

8. Domain d4y9ub1: 4y9u B:63-235 [312480]
   Other proteins in same PDB: d4y9ua2, d4y9ua3, d4y9ub2, d4y9ub3
   automated match to d1ja1a2
   complexed with fad, fmn, nap, po4; mutant

Details for d4y9ub1

PDB Entry: 4y9u, 1.95 Å

PDB Description: rat cypor mutant - g143del

PDB Compounds: (B:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d4y9ub1:

Sequence, based on SEQRES records:

>d4y9ub1 c.23.5.0 (B:63-235) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pvkessfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladl
sslpeidkslvvfcmatygedptdnaqdfydwlqetdvdltgvkfavfglgnktyehfna
mgkyvdqrleqlgaqrifelglgdddgnleedfitwreqfwpavceffgvea

Sequence, based on observed residues (ATOM records):

>d4y9ub1 c.23.5.0 (B:63-235) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pvkessfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladl
sslpeidkslvvfcmatytdnaqdfydwlqetdvdltgvkfavfglgnktyehfnamgky
vdqrleqlgaqrifelglgdddgnleedfitwreqfwpavceffgvea

Timeline for d4y9ub1:

• d4y9ub1 first appeared in SCOPe 2.06
  
• d4y9ub1 appears in SCOPe 2.07