SCOPe 2.05: Domain d1reqb2: 1req B:476-638

Lineage for d1reqb2 (1req B:476-638)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.6: Cobalamin (vitamin B12)-binding domain [52242] (1 family)

5. Family c.23.6.1: Cobalamin (vitamin B12)-binding domain [52243] (5 proteins)

6. Protein Methylmalonyl-CoA mutase beta subunit, C-terminal domain [88719] (1 species)
   inactive subunit

7. Species Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [88720] (8 PDB entries)

8. Domain d1reqb2: 1req B:476-638 [31248]
   Other proteins in same PDB: d1reqa1, d1reqa2, d1reqb1, d1reqc1, d1reqc2, d1reqd1
   complexed with b12, dca, gol

Details for d1reqb2

PDB Entry: 1req, 2 Å

PDB Description: methylmalonyl-coa mutase

PDB Compounds: (B:) methylmalonyl-coa mutase

SCOPe Domain Sequences for d1reqb2:

Sequence; same for both SEQRES and ATOM records:

>d1reqb2 c.23.6.1 (B:476-638) Methylmalonyl-CoA mutase beta subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]}
tkpfpaaparkglawhrdsevfeqlmdrstsvserpkvflaclgtrrdfggregfsspvw
hiagidtpqveggttaeiveafkksgaqvadlcssakvyaqqglevakalkaagakalyl
sgafkefgddaaeaeklidgrlfmgmdvvdtlsstldilgvak

Timeline for d1reqb2:

• d1reqb2 first appeared (with stable ids) in SCOP 1.55
  
• d1reqb2 appears in SCOPe 2.04
  
• d1reqb2 appears in SCOPe 2.06
  
• d1reqb2 appears in the current release, SCOPe 2.08