Lineage for d5aa5l_ (5aa5 L:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2624340Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 2624341Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. 2624506Family e.18.1.0: automated matches [191637] (1 protein)
    not a true family
  6. 2624507Protein automated matches [191173] (15 species)
    not a true protein
  7. 2624522Species Cupriavidus necator [TaxId:381666] [312466] (1 PDB entry)
  8. 2624528Domain d5aa5l_: 5aa5 L: [312475]
    automated match to d3myrd_
    complexed with mla, nfu, sf4

Details for d5aa5l_

PDB Entry: 5aa5 (more details), 2.5 Å

PDB Description: actinobacterial-type nife-hydrogenase from ralstonia eutropha h16 at 2.85 angstrom resolution
PDB Compounds: (L:) nife-hydrogenase large subunit, hofg

SCOPe Domain Sequences for d5aa5l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aa5l_ e.18.1.0 (L:) automated matches {Cupriavidus necator [TaxId: 381666]}
lvemnwdpitrivgslgiytkidfenrrvaecystssifrgysifmkgkdprdshfitsr
icgicgdnhatcsvyaqnmaygvkpppiadwiinlgeaaeymfdhnifqdnlvgvdfceq
mvretnpgvwekaktaeaphaaehgyrtiadimtalnpftgefyretllvsrytremfcl
megrhvhpstlypggvgtvptiqlftdyitrlmkyvefmkkvvplhddlfdffyealpgy
eevgrrrillgcwgsfqdpnvcdynyrtmtkwgrgmfvtpgvvvdgellttdlvdinlni
rillgssfyqdwdheetsvkndplgnavdrkhpwnqttlprpqkrnfggnytwvmsprwl
dkrtgdhlaldtgggpiarlwatalaglvdigyikstghsvkiylprtalkpeaefewki
pmwsnaierdrartyfqaysaaaalyfaeqalaelhagrtrtftdfkvpdeaigcgfhea
vrgvlshhlvirdgkianyhpypptpwnasprdiygtpgpyedavqntpifeengpekfk
gidimravrsfdpclpcgvh

SCOPe Domain Coordinates for d5aa5l_:

Click to download the PDB-style file with coordinates for d5aa5l_.
(The format of our PDB-style files is described here.)

Timeline for d5aa5l_: