Lineage for d5a7cb_ (5a7c B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2319938Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2320170Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2320171Protein automated matches [190615] (14 species)
    not a true protein
  7. 2320183Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries)
  8. 2321201Domain d5a7cb_: 5a7c B: [312474]
    Other proteins in same PDB: d5a7ca2
    automated match to d4qeua_
    protein/DNA complex; complexed with 5d4, edo

Details for d5a7cb_

PDB Entry: 5a7c (more details), 1.9 Å

PDB Description: crystal structure of the second bromodomain of human brd3 in complex with compound
PDB Compounds: (B:) Bromodomain-containing protein 3

SCOPe Domain Sequences for d5a7cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a7cb_ a.29.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gklsehlrycdsilremlskkhaayawpfykpvdaealelhdyhdiikhpmdlstvkrkm
dgreypdaqgfaadvrlmfsncykynppdhevvamarklqdvfemrfakmp

SCOPe Domain Coordinates for d5a7cb_:

Click to download the PDB-style file with coordinates for d5a7cb_.
(The format of our PDB-style files is described here.)

Timeline for d5a7cb_: