| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
| Protein automated matches [190064] (21 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [194524] (2 PDB entries) |
| Domain d5a2ha_: 5a2h A: [312471] automated match to d1rfja_ complexed with act, ca, mpd |
PDB Entry: 5a2h (more details), 2.27 Å
SCOPe Domain Sequences for d5a2ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a2ha_ a.39.1.5 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dqltddqisefkeafslfdkdgdgcittkelgtvmrslgqnpteaelqdminevdadgng
tidfpeflnlmarkmkdtdseeelkeafrvfdkdqngfisaaelrhvmtnlgekltdeev
demireadvdgdgqinyeefvkvmmak
Timeline for d5a2ha_: