Lineage for d1reqa2 (1req A:561-728)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1357234Superfamily c.23.6: Cobalamin (vitamin B12)-binding domain [52242] (1 family) (S)
  5. 1357235Family c.23.6.1: Cobalamin (vitamin B12)-binding domain [52243] (5 proteins)
  6. 1357260Protein Methylmalonyl-CoA mutase alpha subunit, C-terminal domain [88717] (1 species)
    active subunit; binds B12
  7. 1357261Species Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [88718] (8 PDB entries)
  8. 1357264Domain d1reqa2: 1req A:561-728 [31247]
    Other proteins in same PDB: d1reqa1, d1reqb1, d1reqb2, d1reqc1, d1reqd1, d1reqd2
    complexed with b12, dca, gol

Details for d1reqa2

PDB Entry: 1req (more details), 2 Å

PDB Description: methylmalonyl-coa mutase
PDB Compounds: (A:) methylmalonyl-coa mutase

SCOPe Domain Sequences for d1reqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]}
aqirtisgvyskevkntpeveearelveefeqaegrrprillakmgqdghdrgqkviata
yadlgfdvdvgplfqtpeetarqaveadvhvvgvsslagghltlvpalrkeldklgrpdi
litvggvipeqdfdelrkdgaveiytpgtvipesaislvkklraslda

SCOPe Domain Coordinates for d1reqa2:

Click to download the PDB-style file with coordinates for d1reqa2.
(The format of our PDB-style files is described here.)

Timeline for d1reqa2: