![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
![]() | Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
![]() | Protein automated matches [190615] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries) |
![]() | Domain d5a7cc_: 5a7c C: [312457] Other proteins in same PDB: d5a7ca2 automated match to d4qeua_ protein/DNA complex; complexed with 5d4, edo |
PDB Entry: 5a7c (more details), 1.9 Å
SCOPe Domain Sequences for d5a7cc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a7cc_ a.29.2.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lsehlrycdsilremlskkhaayawpfykpvdaealelhdyhdiikhpmdlstvkrkmdg reypdaqgfaadvrlmfsncykynppdhevvamarklqdvfemrfakmp
Timeline for d5a7cc_:
![]() Domains from other chains: (mouse over for more information) d5a7ca1, d5a7ca2, d5a7cb_, d5a7cd_ |