Lineage for d4zvja_ (4zvj A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2413228Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2413229Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 protein domains)
    automatically mapped to Pfam PF00121
  6. 2413579Protein automated matches [196175] (7 species)
    not a true protein
  7. 2413583Species Human (Homo sapiens) [TaxId:9606] [268561] (3 PDB entries)
  8. 2413586Domain d4zvja_: 4zvj A: [312452]
    automated match to d1wyia_
    complexed with k, na

Details for d4zvja_

PDB Entry: 4zvj (more details), 1.7 Å

PDB Description: structure of human triose phosphate isomerase k13m
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d4zvja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zvja_ c.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rkffvggnwmmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpkiavaa
qncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalaeglgv
iacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqqaqe
vheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpefvdi
inakq

SCOPe Domain Coordinates for d4zvja_:

Click to download the PDB-style file with coordinates for d4zvja_.
(The format of our PDB-style files is described here.)

Timeline for d4zvja_: