Lineage for d7reqc2 (7req C:561-728)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857119Superfamily c.23.6: Cobalamin (vitamin B12)-binding domain [52242] (1 family) (S)
  5. 2857120Family c.23.6.1: Cobalamin (vitamin B12)-binding domain [52243] (5 proteins)
  6. 2857149Protein Methylmalonyl-CoA mutase alpha subunit, C-terminal domain [88717] (1 species)
    active subunit; binds B12
  7. 2857150Species Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [88718] (8 PDB entries)
  8. 2857152Domain d7reqc2: 7req C:561-728 [31245]
    Other proteins in same PDB: d7reqa1, d7reqb1, d7reqb2, d7reqc1, d7reqd1, d7reqd2
    complexed with 2cp, b12, gol

Details for d7reqc2

PDB Entry: 7req (more details), 2.2 Å

PDB Description: methylmalonyl-coa mutase, 2-carboxypropyl-coa inhibitor complex
PDB Compounds: (C:) protein (methylmalonyl-coa mutase)

SCOPe Domain Sequences for d7reqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7reqc2 c.23.6.1 (C:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]}
aqirtisgvyskevkntpeveearelveefeqaegrrprillakmgqdghdrgqkviata
yadlgfdvdvgplfqtpeetarqaveadvhvvgvsslagghltlvpalrkeldklgrpdi
litvggvipeqdfdelrkdgaveiytpgtvipesaislvkklraslda

SCOPe Domain Coordinates for d7reqc2:

Click to download the PDB-style file with coordinates for d7reqc2.
(The format of our PDB-style files is described here.)

Timeline for d7reqc2: