Lineage for d4ybll2 (4ybl L:106A-208)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2752281Domain d4ybll2: 4ybl L:106A-208 [312447]
    Other proteins in same PDB: d4yblb1, d4yblb2, d4yblc1, d4yblh1, d4yblh2, d4ybll1
    automated match to d4ocrl2

Details for d4ybll2

PDB Entry: 4ybl (more details), 3.1 Å

PDB Description: crystal structure of the stabilized inner domain of clade a/e hiv-1 gp120 in complex with the adcc mediating anti-hiv-1 antibody a32
PDB Compounds: (L:) A32 antibody light chain

SCOPe Domain Sequences for d4ybll2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ybll2 b.1.1.2 (L:106A-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttps
kqsnnkyaassylsltpeqwkshrsyscqvthegstvektvap

SCOPe Domain Coordinates for d4ybll2:

Click to download the PDB-style file with coordinates for d4ybll2.
(The format of our PDB-style files is described here.)

Timeline for d4ybll2: