Lineage for d4z9ed_ (4z9e D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957073Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2957430Superfamily d.68.6: AlbA-like [82704] (3 families) (S)
  5. 2957478Family d.68.6.0: automated matches [191549] (1 protein)
    not a true family
  6. 2957479Protein automated matches [190948] (3 species)
    not a true protein
  7. 2957484Species Thermoplasma volcanium [TaxId:273116] [312415] (1 PDB entry)
  8. 2957488Domain d4z9ed_: 4z9e D: [312441]
    automated match to d2z7cd_

Details for d4z9ed_

PDB Entry: 4z9e (more details), 2.49 Å

PDB Description: alba from thermoplasma volcanium
PDB Compounds: (D:) DNA/RNA-binding protein Alba

SCOPe Domain Sequences for d4z9ed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z9ed_ d.68.6.0 (D:) automated matches {Thermoplasma volcanium [TaxId: 273116]}
niifvgkkptmnyvlavvtqfnnnankiiikargktiskavdvaeitrhkfipdakyeei
rldtetlqgergssnvssieitlsr

SCOPe Domain Coordinates for d4z9ed_:

Click to download the PDB-style file with coordinates for d4z9ed_.
(The format of our PDB-style files is described here.)

Timeline for d4z9ed_: