SCOPe 2.08: Domain d4yafb1: 4yaf B:65-235

Lineage for d4yafb1 (4yaf B:65-235)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (31 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [255999] (16 PDB entries)

8. Domain d4yafb1: 4yaf B:65-235 [312438]
   Other proteins in same PDB: d4yafa2, d4yafa3, d4yafb2, d4yafb3
   automated match to d1ja1a2
   complexed with 2am, fad, fmn, po4

Details for d4yafb1

PDB Entry: 4yaf, 1.91 Å

PDB Description: rat cypor with 2'-amp

PDB Compounds: (B:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d4yafb1:

Sequence; same for both SEQRES and ATOM records:

>d4yafb1 c.23.5.0 (B:65-235) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kessfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladlss
lpeidkslvvfcmatygegdptdnaqdfydwlqetdvdltgvkfavfglgnktyehfnam
gkyvdqrleqlgaqrifelglgdddgnleedfitwreqfwpavceffgvea

Timeline for d4yafb1:

• d4yafb1 first appeared in SCOPe 2.06
  
• d4yafb1 appears in SCOPe 2.07