Lineage for d7reqa2 (7req A:561-728)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1839015Superfamily c.23.6: Cobalamin (vitamin B12)-binding domain [52242] (1 family) (S)
  5. 1839016Family c.23.6.1: Cobalamin (vitamin B12)-binding domain [52243] (5 proteins)
  6. 1839041Protein Methylmalonyl-CoA mutase alpha subunit, C-terminal domain [88717] (1 species)
    active subunit; binds B12
  7. 1839042Species Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [88718] (8 PDB entries)
  8. 1839043Domain d7reqa2: 7req A:561-728 [31243]
    Other proteins in same PDB: d7reqa1, d7reqb1, d7reqb2, d7reqc1, d7reqd1, d7reqd2
    complexed with 2cp, b12, gol

Details for d7reqa2

PDB Entry: 7req (more details), 2.2 Å

PDB Description: methylmalonyl-coa mutase, 2-carboxypropyl-coa inhibitor complex
PDB Compounds: (A:) protein (methylmalonyl-coa mutase)

SCOPe Domain Sequences for d7reqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]}
aqirtisgvyskevkntpeveearelveefeqaegrrprillakmgqdghdrgqkviata
yadlgfdvdvgplfqtpeetarqaveadvhvvgvsslagghltlvpalrkeldklgrpdi
litvggvipeqdfdelrkdgaveiytpgtvipesaislvkklraslda

SCOPe Domain Coordinates for d7reqa2:

Click to download the PDB-style file with coordinates for d7reqa2.
(The format of our PDB-style files is described here.)

Timeline for d7reqa2: