Lineage for d4zrac1 (4zra C:36-227)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2411926Fold b.125: LolA-like prokaryotic lipoproteins and lipoprotein localization factors [89391] (1 superfamily)
    11 stranded sheet partly folded in a corner-like structure filled with a few short helices
  4. 2411927Superfamily b.125.1: Prokaryotic lipoproteins and lipoprotein localization factors [89392] (4 families) (S)
  5. 2411964Family b.125.1.0: automated matches [191645] (1 protein)
    not a true family
  6. 2411965Protein automated matches [191184] (3 species)
    not a true protein
  7. 2411968Species Mycobacterium tuberculosis [TaxId:83332] [189449] (4 PDB entries)
  8. 2411976Domain d4zrac1: 4zra C:36-227 [312420]
    Other proteins in same PDB: d4zrac2
    automated match to d3mh8a_
    complexed with 4rf

Details for d4zrac1

PDB Entry: 4zra (more details), 1.83 Å

PDB Description: crystal structure of mycobacterium tuberculosis lprg binding to triacylglyceride
PDB Compounds: (C:) Lipoprotein lprG

SCOPe Domain Sequences for d4zrac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zrac1 b.125.1.0 (C:36-227) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
gplpdakplveeataqtkalksahmvltvngkipglslktlsgdlttnptaatgnvkltl
ggsdidadfvvfdgilyatltpnqwsdfgpaadiydpaqvlnpdtglanvlanfadakae
grdtingqntirisgkvsaqavnqiappfnatqpvpatvwiqetgdhqlaqaqldrgsgn
svqmtlskwgek

SCOPe Domain Coordinates for d4zrac1:

Click to download the PDB-style file with coordinates for d4zrac1.
(The format of our PDB-style files is described here.)

Timeline for d4zrac1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zrac2
View in 3D
Domains from other chains:
(mouse over for more information)
d4zraa_