Lineage for d1b1a__ (1b1a -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 22041Superfamily c.23.6: Cobalamin (vitamin B12)-binding domain [52242] (1 family) (S)
  5. 22042Family c.23.6.1: Cobalamin (vitamin B12)-binding domain [52243] (3 proteins)
  6. 22043Protein Glutamate mutase, small subunit [52246] (2 species)
  7. 22044Species Clostridium cochlearium [TaxId:1494] [52248] (3 PDB entries)
  8. 22049Domain d1b1a__: 1b1a - [31242]

Details for d1b1a__

PDB Entry: 1b1a (more details)

PDB Description: glutamate mutase (b12-binding subunit), nmr, minimized average structure

SCOP Domain Sequences for d1b1a__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b1a__ c.23.6.1 (-) Glutamate mutase, small subunit {Clostridium cochlearium}
mekktivlgvigsdchavgnkildhaftnagfnvvnigvlspqevfikaaietkadaill
sslygqgeidckglrqkcdeaglegillyvggnivvgkqhwpdvekrfkdmgydrvyapg
tppevgiadlkkdlnie

SCOP Domain Coordinates for d1b1a__:

Click to download the PDB-style file with coordinates for d1b1a__.
(The format of our PDB-style files is described here.)

Timeline for d1b1a__: