Lineage for d4zraa_ (4zra A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2088429Fold b.125: LolA-like prokaryotic lipoproteins and lipoprotein localization factors [89391] (1 superfamily)
    11 stranded sheet partly folded in a corner-like structure filled with a few short helices
  4. 2088430Superfamily b.125.1: Prokaryotic lipoproteins and lipoprotein localization factors [89392] (4 families) (S)
  5. 2088467Family b.125.1.0: automated matches [191645] (1 protein)
    not a true family
  6. 2088468Protein automated matches [191184] (3 species)
    not a true protein
  7. 2088471Species Mycobacterium tuberculosis [TaxId:83332] [189449] (4 PDB entries)
  8. 2088478Domain d4zraa_: 4zra A: [312417]
    Other proteins in same PDB: d4zrac2
    automated match to d3mh8a_
    complexed with 4rf

Details for d4zraa_

PDB Entry: 4zra (more details), 1.83 Å

PDB Description: crystal structure of mycobacterium tuberculosis lprg binding to triacylglyceride
PDB Compounds: (A:) Lipoprotein lprG

SCOPe Domain Sequences for d4zraa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zraa_ b.125.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
gplpdakplveeataqtkalksahmvltvngkipglslktlsgdlttnptaatgnvkltl
ggsdidadfvvfdgilyatltpnqwsdfgpaadiydpaqvlnpdtglanvlanfadakae
grdtingqntirisgkvsaqavnqiappfnatqpvpatvwiqetgdhqlaqaqldrgsgn
svqmtlskwgekvqvt

SCOPe Domain Coordinates for d4zraa_:

Click to download the PDB-style file with coordinates for d4zraa_.
(The format of our PDB-style files is described here.)

Timeline for d4zraa_: