![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
![]() | Superfamily d.68.6: AlbA-like [82704] (3 families) ![]() |
![]() | Family d.68.6.0: automated matches [191549] (1 protein) not a true family |
![]() | Protein automated matches [190948] (3 species) not a true protein |
![]() | Species Thermoplasma volcanium [TaxId:273116] [312415] (1 PDB entry) |
![]() | Domain d4z9ec_: 4z9e C: [312416] automated match to d2z7cd_ |
PDB Entry: 4z9e (more details), 2.49 Å
SCOPe Domain Sequences for d4z9ec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z9ec_ d.68.6.0 (C:) automated matches {Thermoplasma volcanium [TaxId: 273116]} niifvgkkptmnyvlavvtqfnnnankiiikargktiskavdvaeitrhkfipdakyeei rldtetlqgergssnvssieitlsr
Timeline for d4z9ec_: