Lineage for d4zqca_ (4zqc A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2413784Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2414299Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 protein domains)
  6. 2414329Protein Trp synthase alpha-subunit [51388] (8 species)
  7. 2414378Species Salmonella typhimurium [TaxId:90371] [51389] (46 PDB entries)
  8. 2414396Domain d4zqca_: 4zqc A: [312413]
    Other proteins in same PDB: d4zqcb_
    automated match to d1k8ya_
    complexed with dms, f6f, na, plp

Details for d4zqca_

PDB Entry: 4zqc (more details), 1.54 Å

PDB Description: tryptophan synthase from salmonella typhimurium in complex with two molecules of n-(4'-trifluoromethoxybenzoyl)-2-amino-1-ethylphosphate (f6f) inhibitor in the alpha-site and a single f6f molecule in the beta-site at 1.54 angstrom resolution.
PDB Compounds: (A:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d4zqca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zqca_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]}
meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
ieknlaspkqmlaelrsfvsamkaasra

SCOPe Domain Coordinates for d4zqca_:

Click to download the PDB-style file with coordinates for d4zqca_.
(The format of our PDB-style files is described here.)

Timeline for d4zqca_: