Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (29 species) not a true protein |
Species Unidentified influenza virus [TaxId:119212] [312202] (5 PDB entries) |
Domain d4yy7b_: 4yy7 B: [312409] Other proteins in same PDB: d4yy7a_, d4yy7c_ automated match to d3s12b_ complexed with nag |
PDB Entry: 4yy7 (more details), 2.99 Å
SCOPe Domain Sequences for d4yy7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yy7b_ h.3.1.1 (B:) automated matches {Unidentified influenza virus [TaxId: 119212]} gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqk
Timeline for d4yy7b_: