SCOPe 2.06: Domain d4za3b1: 4za3 B:2-132

Lineage for d4za3b1 (4za3 B:2-132)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.0: automated matches [227190] (1 protein)
   not a true family

6. Protein automated matches [226913] (9 species)
   not a true protein

7. Species Momordica charantia [TaxId:3673] [312303] (9 PDB entries)

8. Domain d4za3b1: 4za3 B:2-132 [312399]
   Other proteins in same PDB: d4za3a_
   automated match to d4hr6c1
   complexed with bma, edo, fuc, gol, nag

Details for d4za3b1

PDB Entry: 4za3, 1.67 Å

PDB Description: structural studies on a non-toxic homologue of type ii rips from momordica charantia (bitter gourd)-native-3

PDB Compounds: (B:) rRNA N-glycosidase

SCOPe Domain Sequences for d4za3b1:

Sequence; same for both SEQRES and ATOM records:

>d4za3b1 b.42.2.0 (B:2-132) automated matches {Momordica charantia [TaxId: 3673]}
eqcspqqrttrisgrdglcvdvygaltadgsrvilypcgqqqnqqwtfypdntirslgkc
latsalssgsnvvitncdylryddgwmvsssgtmmnksshlvltanaatsrtnltgennv
faakqawrign

Timeline for d4za3b1:

• d4za3b1 is new in SCOPe 2.06-stable
  
• d4za3b1 appears in SCOPe 2.07
  
• d4za3b1 appears in the current release, SCOPe 2.08