Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) |
Family d.145.1.0: automated matches [191624] (1 protein) not a true family |
Protein automated matches [191143] (12 species) not a true protein |
Species Sulfolobus tokodaii [TaxId:273063] [312395] (1 PDB entry) |
Domain d4zohb1: 4zoh B:1-170 [312396] Other proteins in same PDB: d4zohb2, d4zohc1, d4zohc2 automated match to d1ffuc2 complexed with 1pe, acy, fad, fes, mcn, mo, peg, pg4 |
PDB Entry: 4zoh (more details), 2.2 Å
SCOPe Domain Sequences for d4zohb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zohb1 d.145.1.0 (B:1-170) automated matches {Sulfolobus tokodaii [TaxId: 273063]} myppkfgyvipdnlnealefleehqdarplagghslipmlklrlirpsyiveirrfsnls yitkdgnlykigaltthyniskssipllsetasnigdpqvrnmgtiggsishldpsadyp aaliamdakvkitsrkgdrvvnfksfakdmftpdlnpgelvteiqvptfe
Timeline for d4zohb1: