Lineage for d4zohb1 (4zoh B:1-170)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2223741Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2223742Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2223984Family d.145.1.0: automated matches [191624] (1 protein)
    not a true family
  6. 2223985Protein automated matches [191143] (10 species)
    not a true protein
  7. 2224036Species Sulfolobus tokodaii [TaxId:273063] [312395] (1 PDB entry)
  8. 2224037Domain d4zohb1: 4zoh B:1-170 [312396]
    Other proteins in same PDB: d4zohb2, d4zohc1, d4zohc2
    automated match to d1ffuc2
    complexed with 1pe, acy, fad, fes, mcn, mo, peg, pg4

Details for d4zohb1

PDB Entry: 4zoh (more details), 2.2 Å

PDB Description: crystal structure of glyceraldehyde oxidoreductase
PDB Compounds: (B:) Putative oxidoreductase FAD-binding subunit

SCOPe Domain Sequences for d4zohb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zohb1 d.145.1.0 (B:1-170) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
myppkfgyvipdnlnealefleehqdarplagghslipmlklrlirpsyiveirrfsnls
yitkdgnlykigaltthyniskssipllsetasnigdpqvrnmgtiggsishldpsadyp
aaliamdakvkitsrkgdrvvnfksfakdmftpdlnpgelvteiqvptfe

SCOPe Domain Coordinates for d4zohb1:

Click to download the PDB-style file with coordinates for d4zohb1.
(The format of our PDB-style files is described here.)

Timeline for d4zohb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zohb2