SCOPe 2.08: Domain d4zohb1: 4zoh B:1-170

Lineage for d4zohb1 (4zoh B:1-170)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.0: automated matches [191624] (1 protein)
   not a true family

6. Protein automated matches [191143] (13 species)
   not a true protein

7. Species Sulfolobus tokodaii [TaxId:273063] [312395] (1 PDB entry)

8. Domain d4zohb1: 4zoh B:1-170 [312396]
   Other proteins in same PDB: d4zohb2, d4zohc1, d4zohc2
   automated match to d1ffuc2
   complexed with 1pe, acy, fad, fes, mcn, mo, peg, pg4

Details for d4zohb1

PDB Entry: 4zoh, 2.2 Å

PDB Description: crystal structure of glyceraldehyde oxidoreductase

PDB Compounds: (B:) Putative oxidoreductase FAD-binding subunit

SCOPe Domain Sequences for d4zohb1:

Sequence; same for both SEQRES and ATOM records:

>d4zohb1 d.145.1.0 (B:1-170) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
myppkfgyvipdnlnealefleehqdarplagghslipmlklrlirpsyiveirrfsnls
yitkdgnlykigaltthyniskssipllsetasnigdpqvrnmgtiggsishldpsadyp
aaliamdakvkitsrkgdrvvnfksfakdmftpdlnpgelvteiqvptfe

Timeline for d4zohb1:

• d4zohb1 first appeared in SCOPe 2.06
  
• d4zohb1 appears in SCOPe 2.07