SCOPe 2.08: Domain d4zm1b1: 4zm1 B:4-240

Lineage for d4zm1b1 (4zm1 B:4-240)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.60: Bacterial polysaccharide co-polymerase-like [160355] (1 family)
   Decorated common fold with extra helical regions, which facilitate oligomerization

5. Family d.58.60.1: FepE-like [160356] (4 proteins)
   the ferredoxin-like fold resides mainly on in the N-terminal part that corresponds to Pfam PF02706 (Wzz)

6. Protein automated matches [195727] (2 species)
   not a true protein

7. Species Shigella flexneri [TaxId:623] [195728] (5 PDB entries)

8. Domain d4zm1b1: 4zm1 B:4-240 [312393]
   Other proteins in same PDB: d4zm1b2
   automated match to d3b8pa1
   complexed with cit, mg

Details for d4zm1b1

PDB Entry: 4zm1, 2.55 Å

PDB Description: shigella flexneri lipopolysaccharide o-antigen chain-length regulator wzzbsf - wild type

PDB Compounds: (B:) Chain length determinant protein

SCOPe Domain Sequences for d4zm1b1:

Sequence; same for both SEQRES and ATOM records:

>d4zm1b1 d.58.60.1 (B:4-240) automated matches {Shigella flexneri [TaxId: 623]}
ekwtstaiitqpdvgqiagynnamnviygqaapkvsdlqetligrfssafsalaetldnq
eepekltiepsvknqqlpltvsyvgqtaegaqmklaqyiqqvddkvnqelekdlkdnial
grknlqdslrtqevvaqeqkdlrirqiqealqyanqaqvtkpqvqqtedvtqdtlfllgs
ealesmikheatrplvfspnyyqtrqnlldieklkfddldihayryvmkptlpirrd

Timeline for d4zm1b1:

• d4zm1b1 first appeared in SCOPe 2.06
  
• d4zm1b1 appears in SCOPe 2.07