Lineage for d4zm1b1 (4zm1 B:4-240)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2956280Superfamily d.58.60: Bacterial polysaccharide co-polymerase-like [160355] (1 family) (S)
    Decorated common fold with extra helical regions, which facilitate oligomerization
  5. 2956281Family d.58.60.1: FepE-like [160356] (4 proteins)
    the ferredoxin-like fold resides mainly on in the N-terminal part that corresponds to Pfam PF02706 (Wzz)
  6. 2956313Protein automated matches [195727] (2 species)
    not a true protein
  7. 2956324Species Shigella flexneri [TaxId:623] [195728] (5 PDB entries)
  8. 2956334Domain d4zm1b1: 4zm1 B:4-240 [312393]
    Other proteins in same PDB: d4zm1b2
    automated match to d3b8pa1
    complexed with cit, mg

Details for d4zm1b1

PDB Entry: 4zm1 (more details), 2.55 Å

PDB Description: shigella flexneri lipopolysaccharide o-antigen chain-length regulator wzzbsf - wild type
PDB Compounds: (B:) Chain length determinant protein

SCOPe Domain Sequences for d4zm1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zm1b1 d.58.60.1 (B:4-240) automated matches {Shigella flexneri [TaxId: 623]}
ekwtstaiitqpdvgqiagynnamnviygqaapkvsdlqetligrfssafsalaetldnq
eepekltiepsvknqqlpltvsyvgqtaegaqmklaqyiqqvddkvnqelekdlkdnial
grknlqdslrtqevvaqeqkdlrirqiqealqyanqaqvtkpqvqqtedvtqdtlfllgs
ealesmikheatrplvfspnyyqtrqnlldieklkfddldihayryvmkptlpirrd

SCOPe Domain Coordinates for d4zm1b1:

Click to download the PDB-style file with coordinates for d4zm1b1.
(The format of our PDB-style files is described here.)

Timeline for d4zm1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zm1b2