SCOPe 2.08: Domain d4ysea2: 4yse A:162-340

Lineage for d4ysea2 (4yse A:162-340)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (31 species)
   not a true protein

7. Species Alcaligenes faecalis [TaxId:511] [226762] (16 PDB entries)

8. Domain d4ysea2: 4yse A:162-340 [312392]
   automated match to d2e86a2
   complexed with acy, cu, mpd

Details for d4ysea2

PDB Entry: 4yse, 1.2 Å

PDB Description: high resolution synchrotron structure of copper nitrite reductase from alcaligenes faecalis

PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d4ysea2:

Sequence; same for both SEQRES and ATOM records:

>d4ysea2 b.6.1.0 (A:162-340) automated matches {Alcaligenes faecalis [TaxId: 511]}
lhdgkgkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfn
gavgaltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetw
fipggaagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsgt

Timeline for d4ysea2:

• d4ysea2 first appeared in SCOPe 2.06
  
• d4ysea2 appears in SCOPe 2.07