Lineage for d1ccwc_ (1ccw C:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 22041Superfamily c.23.6: Cobalamin (vitamin B12)-binding domain [52242] (1 family) (S)
  5. 22042Family c.23.6.1: Cobalamin (vitamin B12)-binding domain [52243] (3 proteins)
  6. 22043Protein Glutamate mutase, small subunit [52246] (2 species)
  7. 22044Species Clostridium cochlearium [TaxId:1494] [52248] (3 PDB entries)
  8. 22046Domain d1ccwc_: 1ccw C: [31239]
    Other proteins in same PDB: d1ccwb_, d1ccwd_

Details for d1ccwc_

PDB Entry: 1ccw (more details), 1.6 Å

PDB Description: structure of the coenzyme b12 dependent enzyme glutamate mutase from clostridium cochlearium

SCOP Domain Sequences for d1ccwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ccwc_ c.23.6.1 (C:) Glutamate mutase, small subunit {Clostridium cochlearium}
mekktivlgvigsdchavgnkildhaftnagfnvvnigvlspqelfikaaietkadailv
sslygqgeidckglrqkcdeaglegillyvggnivvgkqhwpdvekrfkdmgydrvyapg
tppevgiadlkkdlnie

SCOP Domain Coordinates for d1ccwc_:

Click to download the PDB-style file with coordinates for d1ccwc_.
(The format of our PDB-style files is described here.)

Timeline for d1ccwc_: