SCOPe 2.08: Domain d4zohc2: 4zoh C:88-161

Lineage for d4zohc2 (4zoh C:88-161)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
   core: 4 helices, bundle

4. Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families)
   contains 2Fe-2S cluster

5. Family a.56.1.0: automated matches [227241] (1 protein)
   not a true family

6. Protein automated matches [227007] (6 species)
   not a true protein

7. Species Sulfolobus tokodaii [TaxId:273063] [312380] (1 PDB entry)

8. Domain d4zohc2: 4zoh C:88-161 [312381]
   Other proteins in same PDB: d4zohb1, d4zohb2, d4zohc1
   automated match to d3hrdd2
   complexed with 1pe, acy, fad, fes, mcn, mo, peg, pg4

Details for d4zohc2

PDB Entry: 4zoh, 2.2 Å

PDB Description: crystal structure of glyceraldehyde oxidoreductase

PDB Compounds: (C:) Putative oxidoreductase iron-sulfur subunit

SCOPe Domain Sequences for d4zohc2:

Sequence; same for both SEQRES and ATOM records:

>d4zohc2 a.56.1.0 (C:88-161) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
dgklhpiqeafwenhalqcgyctpgmimeaywllrekpnpteeeiregisgnlcrctgyq
nivkaikaaaekls

Timeline for d4zohc2:

• d4zohc2 first appeared in SCOPe 2.06
  
• d4zohc2 appears in SCOPe 2.07