Lineage for d4zohc2 (4zoh C:88-161)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715250Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 2715251Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 2715358Family a.56.1.0: automated matches [227241] (1 protein)
    not a true family
  6. 2715359Protein automated matches [227007] (6 species)
    not a true protein
  7. 2715379Species Sulfolobus tokodaii [TaxId:273063] [312380] (1 PDB entry)
  8. 2715380Domain d4zohc2: 4zoh C:88-161 [312381]
    Other proteins in same PDB: d4zohb1, d4zohb2, d4zohc1
    automated match to d3hrdd2
    complexed with 1pe, acy, fad, fes, mcn, mo, peg, pg4

Details for d4zohc2

PDB Entry: 4zoh (more details), 2.2 Å

PDB Description: crystal structure of glyceraldehyde oxidoreductase
PDB Compounds: (C:) Putative oxidoreductase iron-sulfur subunit

SCOPe Domain Sequences for d4zohc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zohc2 a.56.1.0 (C:88-161) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
dgklhpiqeafwenhalqcgyctpgmimeaywllrekpnpteeeiregisgnlcrctgyq
nivkaikaaaekls

SCOPe Domain Coordinates for d4zohc2:

Click to download the PDB-style file with coordinates for d4zohc2.
(The format of our PDB-style files is described here.)

Timeline for d4zohc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zohc1