| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily) core: 4 helices, bundle |
Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) ![]() contains 2Fe-2S cluster |
| Family a.56.1.0: automated matches [227241] (1 protein) not a true family |
| Protein automated matches [227007] (6 species) not a true protein |
| Species Sulfolobus tokodaii [TaxId:273063] [312380] (1 PDB entry) |
| Domain d4zohc2: 4zoh C:88-161 [312381] Other proteins in same PDB: d4zohb1, d4zohb2, d4zohc1 automated match to d3hrdd2 complexed with 1pe, acy, fad, fes, mcn, mo, peg, pg4 |
PDB Entry: 4zoh (more details), 2.2 Å
SCOPe Domain Sequences for d4zohc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zohc2 a.56.1.0 (C:88-161) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
dgklhpiqeafwenhalqcgyctpgmimeaywllrekpnpteeeiregisgnlcrctgyq
nivkaikaaaekls
Timeline for d4zohc2: