![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
![]() | Protein automated matches [191164] (24 species) not a true protein |
![]() | Species Sulfolobus tokodaii [TaxId:273063] [312378] (1 PDB entry) |
![]() | Domain d4zohc1: 4zoh C:1-87 [312379] Other proteins in same PDB: d4zohb1, d4zohb2, d4zohc2 automated match to d3hrdd1 complexed with 1pe, acy, fad, fes, mcn, mo, peg, pg4 |
PDB Entry: 4zoh (more details), 2.2 Å
SCOPe Domain Sequences for d4zohc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zohc1 d.15.4.0 (C:1-87) automated matches {Sulfolobus tokodaii [TaxId: 273063]} mkiinsdqkvkitlkingekyeteveprrllvhvlrelgftgvhigcdtsncgactvimn gksvksctvlaveadgaeiltveglak
Timeline for d4zohc1: