SCOPe 2.08: Domain d4zohc1: 4zoh C:1-87

Lineage for d4zohc1 (4zoh C:1-87)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.0: automated matches [191632] (1 protein)
   not a true family

6. Protein automated matches [191164] (24 species)
   not a true protein

7. Species Sulfolobus tokodaii [TaxId:273063] [312378] (1 PDB entry)

8. Domain d4zohc1: 4zoh C:1-87 [312379]
   Other proteins in same PDB: d4zohb1, d4zohb2, d4zohc2
   automated match to d3hrdd1
   complexed with 1pe, acy, fad, fes, mcn, mo, peg, pg4

Details for d4zohc1

PDB Entry: 4zoh, 2.2 Å

PDB Description: crystal structure of glyceraldehyde oxidoreductase

PDB Compounds: (C:) Putative oxidoreductase iron-sulfur subunit

SCOPe Domain Sequences for d4zohc1:

Sequence; same for both SEQRES and ATOM records:

>d4zohc1 d.15.4.0 (C:1-87) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
mkiinsdqkvkitlkingekyeteveprrllvhvlrelgftgvhigcdtsncgactvimn
gksvksctvlaveadgaeiltveglak

Timeline for d4zohc1:

• d4zohc1 first appeared in SCOPe 2.06
  
• d4zohc1 appears in SCOPe 2.07