Lineage for d4zohc1 (4zoh C:1-87)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2503073Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2503459Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 2503460Protein automated matches [191164] (22 species)
    not a true protein
  7. 2503547Species Sulfolobus tokodaii [TaxId:273063] [312378] (1 PDB entry)
  8. 2503548Domain d4zohc1: 4zoh C:1-87 [312379]
    Other proteins in same PDB: d4zohb1, d4zohb2, d4zohc2
    automated match to d3hrdd1
    complexed with 1pe, acy, fad, fes, mcn, mo, peg, pg4

Details for d4zohc1

PDB Entry: 4zoh (more details), 2.2 Å

PDB Description: crystal structure of glyceraldehyde oxidoreductase
PDB Compounds: (C:) Putative oxidoreductase iron-sulfur subunit

SCOPe Domain Sequences for d4zohc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zohc1 d.15.4.0 (C:1-87) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
mkiinsdqkvkitlkingekyeteveprrllvhvlrelgftgvhigcdtsncgactvimn
gksvksctvlaveadgaeiltveglak

SCOPe Domain Coordinates for d4zohc1:

Click to download the PDB-style file with coordinates for d4zohc1.
(The format of our PDB-style files is described here.)

Timeline for d4zohc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zohc2