SCOPe 2.06: Domain d4zn1b1: 4zn1 B:2-59

Lineage for d4zn1b1 (4zn1 B:2-59)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.9: RNA polymerase subunits [63393] (3 families)

5. Family g.41.9.0: automated matches [191622] (1 protein)
   not a true family

6. Protein automated matches [191140] (2 species)
   not a true protein

7. Species Methanocaldococcus jannaschii [TaxId:243232] [312356] (2 PDB entries)

8. Domain d4zn1b1: 4zn1 B:2-59 [312372]
   Other proteins in same PDB: d4zn1b2
   automated match to d3lpeb_
   complexed with zn

Details for d4zn1b1

PDB Entry: 4zn1, 2.8 Å

PDB Description: crystal structure of mjspt4:spt5 complex conformation a

PDB Compounds: (B:) Transcription elongation factor SPT4

SCOPe Domain Sequences for d4zn1b1:

Sequence; same for both SEQRES and ATOM records:

>d4zn1b1 g.41.9.0 (B:2-59) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
raclkckyltndeicpichsptsenwigllivinpekseiakkagidikgkyalsvke

Timeline for d4zn1b1:

• d4zn1b1 is new in SCOPe 2.06-stable
  
• d4zn1b1 appears in SCOPe 2.07
  
• d4zn1b1 appears in the current release, SCOPe 2.08