Lineage for d4zn1b1 (4zn1 B:2-59)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3037235Superfamily g.41.9: RNA polymerase subunits [63393] (3 families) (S)
  5. 3037291Family g.41.9.0: automated matches [191622] (1 protein)
    not a true family
  6. 3037292Protein automated matches [191140] (5 species)
    not a true protein
  7. 3037300Species Methanocaldococcus jannaschii [TaxId:243232] [312356] (2 PDB entries)
  8. 3037302Domain d4zn1b1: 4zn1 B:2-59 [312372]
    Other proteins in same PDB: d4zn1b2
    automated match to d3lpeb_
    complexed with zn

Details for d4zn1b1

PDB Entry: 4zn1 (more details), 2.8 Å

PDB Description: crystal structure of mjspt4:spt5 complex conformation a
PDB Compounds: (B:) Transcription elongation factor SPT4

SCOPe Domain Sequences for d4zn1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zn1b1 g.41.9.0 (B:2-59) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
raclkckyltndeicpichsptsenwigllivinpekseiakkagidikgkyalsvke

SCOPe Domain Coordinates for d4zn1b1:

Click to download the PDB-style file with coordinates for d4zn1b1.
(The format of our PDB-style files is described here.)

Timeline for d4zn1b1: