Lineage for d1be1a_ (1be1 A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.6: Cobalamin (vitamin B12)-binding domain [52242] (1 family) 
Family c.23.6.1: Cobalamin (vitamin B12)-binding domain [52243] (5 proteins) Protein Glutamate mutase, small subunit [52246] (2 species) 
Species Clostridium tetanomorphum [TaxId:1553] [52247] (3 PDB entries) 
Domain d1be1a_: 1be1 A: [31237]
Details for d1be1a_
PDB Entry: 1be1 (more details)
PDB Description: glutamate mutase (b12-binding subunit), nmr, minimized average structure
PDB Compounds: (A:) glutamate mutaseSCOPe Domain Sequences for d1be1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1be1a_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium tetanomorphum [TaxId: 1553]}
mekktivlgvigsdchavgnkildhsftnagfnvvnigvlssqedfinaaietkadlicv
sslygqgeidckglrekcdeaglkgiklfvggnivvgkqnwpdveqrfkamgfdrvyppg
tspettiadmkevlgve
SCOPe Domain Coordinates for d1be1a_:
Click to download the PDB-style file with coordinates for d1be1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1be1a_:
- d1be1a_ first appeared (with stable ids) in SCOP 1.55, called d1be1__
- d1be1a_ appears in SCOPe 2.05
- d1be1a_ appears in SCOPe 2.07
- d1be1a_ appears in the current release, SCOPe 2.08
View in 3D