Lineage for d1be1__ (1be1 -)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.23: Flavodoxin-like [52171] (17 superfamilies) 
Superfamily c.23.6: Cobalamin (vitamin B12)-binding domain [52242] (1 family) 
Family c.23.6.1: Cobalamin (vitamin B12)-binding domain [52243] (3 proteins) Protein Glutamate mutase, small subunit [52246] (2 species) 
Species Clostridium tetanomorphum [TaxId:1553] [52247] (2 PDB entries) 
Domain d1be1__: 1be1 - [31237]
Details for d1be1__
PDB Entry: 1be1 (more details)
PDB Description: glutamate mutase (b12-binding subunit), nmr, minimized average structure
SCOP Domain Sequences for d1be1__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1be1__ c.23.6.1 (-) Glutamate mutase, small subunit {Clostridium tetanomorphum}
mekktivlgvigsdchavgnkildhsftnagfnvvnigvlssqedfinaaietkadlicv
sslygqgeidckglrekcdeaglkgiklfvggnivvgkqnwpdveqrfkamgfdrvyppg
tspettiadmkevlgve
SCOP Domain Coordinates for d1be1__:
Click to download the PDB-style file with coordinates for d1be1__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1be1__:
- d1be1__ first appeared (with stable ids) in SCOP 1.55
- d1be1__ appears in SCOP 1.59
- d1be1__ appears in the current release, SCOPe 2.08, called d1be1a_
View in 3D