Lineage for d1be1__ (1be1 -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 22041Superfamily c.23.6: Cobalamin (vitamin B12)-binding domain [52242] (1 family) (S)
  5. 22042Family c.23.6.1: Cobalamin (vitamin B12)-binding domain [52243] (3 proteins)
  6. 22043Protein Glutamate mutase, small subunit [52246] (2 species)
  7. 22050Species Clostridium tetanomorphum [TaxId:1553] [52247] (1 PDB entry)
  8. 22051Domain d1be1__: 1be1 - [31237]

Details for d1be1__

PDB Entry: 1be1 (more details)

PDB Description: glutamate mutase (b12-binding subunit), nmr, minimized average structure

SCOP Domain Sequences for d1be1__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1be1__ c.23.6.1 (-) Glutamate mutase, small subunit {Clostridium tetanomorphum}
mekktivlgvigsdchavgnkildhsftnagfnvvnigvlssqedfinaaietkadlicv
sslygqgeidckglrekcdeaglkgiklfvggnivvgkqnwpdveqrfkamgfdrvyppg
tspettiadmkevlgve

SCOP Domain Coordinates for d1be1__:

Click to download the PDB-style file with coordinates for d1be1__.
(The format of our PDB-style files is described here.)

Timeline for d1be1__: