SCOPe 2.08: Domain d1bmtb2: 1bmt B:741-896

Lineage for d1bmtb2 (1bmt B:741-896)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.6: Cobalamin (vitamin B12)-binding domain [52242] (1 family)

5. Family c.23.6.1: Cobalamin (vitamin B12)-binding domain [52243] (5 proteins)

6. Protein Methionine synthase, C-terminal domain [52244] (1 species)

7. Species Escherichia coli [TaxId:562] [52245] (5 PDB entries)

8. Domain d1bmtb2: 1bmt B:741-896 [31236]
   Other proteins in same PDB: d1bmta1, d1bmtb1
   complexed with cob

Details for d1bmtb2

PDB Entry: 1bmt, 3 Å

PDB Description: how a protein binds b12: a 3.o angstrom x-ray structure of the b12- binding domains of methionine synthase

PDB Compounds: (B:) methionine synthase

SCOPe Domain Sequences for d1bmtb2:

Sequence; same for both SEQRES and ATOM records:

>d1bmtb2 c.23.6.1 (B:741-896) Methionine synthase, C-terminal domain {Escherichia coli [TaxId: 562]}
eqgktngkmviatvkgdvhdigknivgvvlqcnnyeivdlgvmvpaekilrtakevnadl
iglsglitpsldemvnvakemerqgftiplliggattskahtavkieqnysgptvyvqna
srtvgvvaallsdtqrddfvartrkeyetvriqhgr

Timeline for d1bmtb2:

• d1bmtb2 first appeared (with stable ids) in SCOP 1.55
  
• d1bmtb2 appears in SCOPe 2.07