Lineage for d4zn3b1 (4zn3 B:2-59)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2263789Superfamily g.41.9: RNA polymerase subunits [63393] (3 families) (S)
  5. 2263844Family g.41.9.0: automated matches [191622] (1 protein)
    not a true family
  6. 2263845Protein automated matches [191140] (2 species)
    not a true protein
  7. 2263851Species Methanocaldococcus jannaschii [TaxId:243232] [312356] (2 PDB entries)
  8. 2263852Domain d4zn3b1: 4zn3 B:2-59 [312357]
    Other proteins in same PDB: d4zn3b2
    automated match to d3lpeb_
    complexed with fe, gol, zn

Details for d4zn3b1

PDB Entry: 4zn3 (more details), 2.3 Å

PDB Description: crystal structure of mjspt4:spt5 complex conformation b
PDB Compounds: (B:) Transcription elongation factor SPT4

SCOPe Domain Sequences for d4zn3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zn3b1 g.41.9.0 (B:2-59) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
raclkckyltndeicpichsptsenwigllivinpekseiakkagidikgkyalsvke

SCOPe Domain Coordinates for d4zn3b1:

Click to download the PDB-style file with coordinates for d4zn3b1.
(The format of our PDB-style files is described here.)

Timeline for d4zn3b1: