Lineage for d4yy0c_ (4yy0 C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2047495Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2047496Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2048164Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2048165Protein automated matches [227017] (34 species)
    not a true protein
  7. 2048495Species Unidentified influenza virus [TaxId:119212] [312272] (6 PDB entries)
  8. 2048500Domain d4yy0c_: 4yy0 C: [312352]
    Other proteins in same PDB: d4yy0b_, d4yy0d_, d4yy0f_
    automated match to d4xkgc_
    complexed with 5ax

Details for d4yy0c_

PDB Entry: 4yy0 (more details), 2.59 Å

PDB Description: the structure of hemagglutinin from a h6n1 influenza virus (a/chicken/taiwan/a2837/2013)
PDB Compounds: (C:) ha1

SCOPe Domain Sequences for d4yy0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yy0c_ b.19.1.0 (C:) automated matches {Unidentified influenza virus [TaxId: 119212]}
dkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctiegw
ilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpks
twagvdtsrgvtnacpsytldssfyrnlvwlvktdsatypvikgtynntgtqpilyfwgv
hhppdttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpget
lnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtiagvlktnktfqnvspl
wigecpkyvkseslrlatglrnvpq

SCOPe Domain Coordinates for d4yy0c_:

Click to download the PDB-style file with coordinates for d4yy0c_.
(The format of our PDB-style files is described here.)

Timeline for d4yy0c_: