| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein automated matches [193445] (8 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [193446] (79 PDB entries) |
| Domain d4z2mi_: 4z2m I: [312348] Other proteins in same PDB: d4z2mh_, d4z2mj_ automated match to d1eqzc_ protein/DNA complex |
PDB Entry: 4z2m (more details), 2.98 Å
SCOPe Domain Sequences for d4z2mi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z2mi_ a.22.1.1 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
llirklpfqrlvreiaqdfktdlrfqssavmalqeaceaylvglfedtnlcaihakrvti
mpkdiqlarrirgera
Timeline for d4z2mi_: