SCOPe 2.06: Domain d4yrza_: 4yrz A:

Lineage for d4yrza_ (4yrz A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)

6. Protein Quorum-sensing signal (autoinducer-2) binding protein LuxP [69622] (1 species)

7. Species Vibrio harveyi [TaxId:669] [69623] (6 PDB entries)

8. Domain d4yrza_: 4yrz A: [312346]
   automated match to d1zhha_
   complexed with a2b

Details for d4yrza_

PDB Entry: 4yrz, 2.57 Å

PDB Description: crystal structure of luxp in complex with l-xylulofuranose-1,2-borate

PDB Compounds: (A:) Autoinducer 2-binding periplasmic protein luxP

SCOPe Domain Sequences for d4yrza_:

Sequence; same for both SEQRES and ATOM records:

>d4yrza_ c.93.1.1 (A:) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]}
ngywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdywvrn
iasfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrhrkfve
hvldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyysvly
fsegyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfiyacs
tdvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamaeaikw
dledkpvptvysgdfeivtkadsperiealkkrafrysd

Timeline for d4yrza_:

• d4yrza_ is new in SCOPe 2.06-stable
  
• d4yrza_ appears in SCOPe 2.07
  
• d4yrza_ appears in the current release, SCOPe 2.08