| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.60: Bacterial polysaccharide co-polymerase-like [160355] (1 family) ![]() Decorated common fold with extra helical regions, which facilitate oligomerization |
| Family d.58.60.1: FepE-like [160356] (4 proteins) the ferredoxin-like fold resides mainly on in the N-terminal part that corresponds to Pfam PF02706 (Wzz) |
| Protein automated matches [195727] (2 species) not a true protein |
| Species Shigella flexneri [TaxId:623] [195728] (5 PDB entries) |
| Domain d4zm5b_: 4zm5 B: [312345] automated match to d3b8pa1 complexed with cl, mg; mutant |
PDB Entry: 4zm5 (more details), 2.47 Å
SCOPe Domain Sequences for d4zm5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zm5b_ d.58.60.1 (B:) automated matches {Shigella flexneri [TaxId: 623]}
kwtstaiitqpdvgqiagynnamnviygqaapkvsdlqetligrfssafsalpetldnqe
epekltiepsvknqqlpltvsyvgqtaegaqmklaqyiqqvddkvnqelekdlkdnialg
rknlqdslrtqevvaqeqkdlrirqiqealqyanqaqvtkpqvqqtedvtqdtlfllgse
alesmikheatrplvfspnyyqtrqnlldieklkfddldihayryvmkptlpirrds
Timeline for d4zm5b_: