Lineage for d4z5tb_ (4z5t B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311419Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2311420Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2311421Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2311791Protein Histone H4 [47125] (7 species)
  7. 2311950Species Human (Homo sapiens) [TaxId:9606] [192456] (36 PDB entries)
  8. 2311991Domain d4z5tb_: 4z5t B: [312343]
    Other proteins in same PDB: d4z5tc_, d4z5td_, d4z5tg_, d4z5th_
    automated match to d1kx5b_
    protein/DNA complex

Details for d4z5tb_

PDB Entry: 4z5t (more details), 2.8 Å

PDB Description: the nucleosome containing human h3.5
PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d4z5tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z5tb_ a.22.1.1 (B:) Histone H4 {Human (Homo sapiens) [TaxId: 9606]}
kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
tvtamdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d4z5tb_:

Click to download the PDB-style file with coordinates for d4z5tb_.
(The format of our PDB-style files is described here.)

Timeline for d4z5tb_: