| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H4 [47125] (7 species) |
| Species Human (Homo sapiens) [TaxId:9606] [192456] (36 PDB entries) |
| Domain d4z5tb_: 4z5t B: [312343] Other proteins in same PDB: d4z5tc_, d4z5td_, d4z5tg_, d4z5th_ automated match to d1kx5b_ protein/DNA complex |
PDB Entry: 4z5t (more details), 2.8 Å
SCOPe Domain Sequences for d4z5tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z5tb_ a.22.1.1 (B:) Histone H4 {Human (Homo sapiens) [TaxId: 9606]}
kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
tvtamdvvyalkrqgrtlygfgg
Timeline for d4z5tb_: