Lineage for d4yb5a2 (4yb5 A:225-299)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557428Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2557730Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 2557731Protein automated matches [190753] (21 species)
    not a true protein
  7. 2557778Species Campylobacter jejuni [TaxId:195099] [311910] (3 PDB entries)
  8. 2557797Domain d4yb5a2: 4yb5 A:225-299 [312340]
    Other proteins in same PDB: d4yb5a1, d4yb5b1, d4yb5c1, d4yb5d1, d4yb5e1, d4yb5f1
    automated match to d1h3da2
    complexed with his, k, peg, pge, scn

Details for d4yb5a2

PDB Entry: 4yb5 (more details), 2.24 Å

PDB Description: adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with the allosteric inhibitor histidine
PDB Compounds: (A:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d4yb5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yb5a2 d.58.5.0 (A:225-299) automated matches {Campylobacter jejuni [TaxId: 195099]}
eskyimlhapkekldkiqallpgverptilplahdeknvalhmvskenlfwetmealkee
gassilvlpiekmlk

SCOPe Domain Coordinates for d4yb5a2:

Click to download the PDB-style file with coordinates for d4yb5a2.
(The format of our PDB-style files is described here.)

Timeline for d4yb5a2: