| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
| Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
| Protein automated matches [190753] (21 species) not a true protein |
| Species Campylobacter jejuni [TaxId:195099] [311910] (3 PDB entries) |
| Domain d4yb5a2: 4yb5 A:225-299 [312340] Other proteins in same PDB: d4yb5a1, d4yb5b1, d4yb5c1, d4yb5d1, d4yb5e1, d4yb5f1 automated match to d1h3da2 complexed with his, k, peg, pge, scn |
PDB Entry: 4yb5 (more details), 2.24 Å
SCOPe Domain Sequences for d4yb5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yb5a2 d.58.5.0 (A:225-299) automated matches {Campylobacter jejuni [TaxId: 195099]}
eskyimlhapkekldkiqallpgverptilplahdeknvalhmvskenlfwetmealkee
gassilvlpiekmlk
Timeline for d4yb5a2: