Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.23: Flavodoxin-like [52171] (17 superfamilies) |
Superfamily c.23.5: Flavoproteins [52218] (3 families) |
Family c.23.5.3: Quinone reductase [52235] (2 proteins) |
Protein Quinone reductase type 2 (menadione reductase) [52240] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [52241] (2 PDB entries) |
Domain d2qr2b_: 2qr2 B: [31234] |
PDB Entry: 2qr2 (more details), 2.45 Å
SCOP Domain Sequences for d2qr2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qr2b_ c.23.5.3 (B:) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens)} agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq
Timeline for d2qr2b_: