SCOP 1.57: Domain d2qr2b_: 2qr2 B:

Lineage for d2qr2b_ (2qr2 B:)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.23: Flavodoxin-like [52171] (17 superfamilies)

4. Superfamily c.23.5: Flavoproteins [52218] (3 families)

5. Family c.23.5.3: Quinone reductase [52235] (2 proteins)

6. Protein Quinone reductase type 2 (menadione reductase) [52240] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52241] (2 PDB entries)

8. Domain d2qr2b_: 2qr2 B: [31234]

Details for d2qr2b_

PDB Entry: 2qr2, 2.45 Å

PDB Description: human quinone reductase type 2, complex with menadione

SCOP Domain Sequences for d2qr2b_:

Sequence; same for both SEQRES and ATOM records:

>d2qr2b_ c.23.5.3 (B:) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens)}
agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq

Timeline for d2qr2b_:

• d2qr2b_ first appeared (with stable ids) in SCOP 1.55
  
• d2qr2b_ appears in SCOP 1.59
  
• d2qr2b_ appears in the current release, SCOPe 2.08