Lineage for d4zb0a_ (4zb0 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839044Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2839095Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. 2839096Protein D-xylose isomerase [51666] (13 species)
  7. 2839224Species Streptomyces rubiginosus [TaxId:1929] [51670] (89 PDB entries)
  8. 2839300Domain d4zb0a_: 4zb0 A: [312335]
    automated match to d4xisa_
    complexed with fru, glc, mn

Details for d4zb0a_

PDB Entry: 4zb0 (more details), 2 Å

PDB Description: a dehydrated form of glucose isomerase collected at room temperature.
PDB Compounds: (A:) xylose isomerase

SCOPe Domain Sequences for d4zb0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zb0a_ c.1.15.3 (A:) D-xylose isomerase {Streptomyces rubiginosus [TaxId: 1929]}
nyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlipf
gssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrktir
nidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfaie
pkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagkl
fhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvwa
saagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeefd
vdaaaargmaferldqlamdhllgarg

SCOPe Domain Coordinates for d4zb0a_:

Click to download the PDB-style file with coordinates for d4zb0a_.
(The format of our PDB-style files is described here.)

Timeline for d4zb0a_: