Lineage for d4zi3a1 (4zi3 A:3-182)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2447791Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2447792Protein ADP-ribosylation factor [52614] (16 species)
  7. 2447870Species Mouse (Mus musculus), ARL3 [TaxId:10090] [52618] (3 PDB entries)
  8. 2447874Domain d4zi3a1: 4zi3 A:3-182 [312333]
    Other proteins in same PDB: d4zi3a2
    automated match to d1fzqa_
    complexed with gnp, mg

Details for d4zi3a1

PDB Entry: 4zi3 (more details), 2 Å

PDB Description: bart-like domain of bartl1/ccdc104 aa1-133 in complex with arl3fl bound to gppnhp in p1 21 1
PDB Compounds: (A:) ADP-ribosylation factor-like protein 3

SCOPe Domain Sequences for d4zi3a1:

Sequence, based on SEQRES records: (download)

>d4zi3a1 c.37.1.8 (A:3-182) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]}
llsilrklksapdqevrilllgldnagkttllkqlasedishitptqgfniksvqsqgfk
lnvwdiggqrkirpywrsyfentdiliyvidsadrkrfeetgqeltelleeeklscvpvl
ifankqdlltaapaseiaeglnlhtirdrvwqiqscsaltgegvqdgmnwvcknvnakkk

Sequence, based on observed residues (ATOM records): (download)

>d4zi3a1 c.37.1.8 (A:3-182) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]}
llsilrklksapqevrilllgldnagkttllkqlasedishitptqgfniksvqsqgfkl
nvwdiggqrkirpywrsyfentdiliyvidsadrkrfeetgqeltelleeeklscvpvli
fankqdlltaapaseiaeglnlhtirdrvwqiqscsaltgegvqdgmnwvcknvnakkk

SCOPe Domain Coordinates for d4zi3a1:

Click to download the PDB-style file with coordinates for d4zi3a1.
(The format of our PDB-style files is described here.)

Timeline for d4zi3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zi3a2
View in 3D
Domains from other chains:
(mouse over for more information)
d4zi3b_