Lineage for d4zbea_ (4zbe A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2619748Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2619749Protein automated matches [190857] (70 species)
    not a true protein
  7. 2620117Species Klebsiella pneumoniae [TaxId:573] [225260] (109 PDB entries)
  8. 2620218Domain d4zbea_: 4zbe A: [312330]
    automated match to d3c5aa_
    complexed with cit, nxl

Details for d4zbea_

PDB Entry: 4zbe (more details), 1.8 Å

PDB Description: crystal structure of kpc-2 beta-lactamase complexed with avibactam
PDB Compounds: (A:) Carbapenem-hydrolyzing beta-lactamase KPC

SCOPe Domain Sequences for d4zbea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zbea_ e.3.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
tnlvaepfakleqdfggsigvyamdtgsgatvsyraeerfplcssfkgflaaavlarsqq
qaglldtpirygknalvpwspisekylttgmtvaelsaaavqysdnaaanlllkelggpa
gltafmrsigdttfrldrwelelnsaipgdardtsspravteslqkltlgsalaapqrqq
fvdwlkgnttgnhriraavpadwavgdktgtcgvygtandyavvwptgrapivlavytra
pnkddkhseaviaaaarlaleglg

SCOPe Domain Coordinates for d4zbea_:

Click to download the PDB-style file with coordinates for d4zbea_.
(The format of our PDB-style files is described here.)

Timeline for d4zbea_: